PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ahy007354
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family WRKY
Protein Properties Length: 313aa    MW: 34640.6 Da    PI: 6.9542
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Ahy#S59542421PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY1031.7e-3270127260
                --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
       WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                dDgynWrKYGqK vkgsefprsYY+Ct+++C+vkk  ers+ d++++ei+Y+g+H+h+k
  Ahy007354  70 DDGYNWRKYGQKLVKGSEFPRSYYKCTHPNCEVKKLFERSH-DGQITEIIYKGTHDHPK 127
                8****************************************.***************85 PP

2WRKY107.56.7e-34244302159
                ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
       WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                ldDgy+WrKYGqK+v+g+++prsYY+Ct agCpv+k+ver+++dpk+v++tYeg+Hnh+
  Ahy007354 244 LDDGYRWRKYGQKVVRGNPNPRSYYKCTNAGCPVRKHVERASHDPKAVITTYEGKHNHD 302
                59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081123.67464128IPR003657WRKY domain
SuperFamilySSF1182902.48E-2567128IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.9E-2767128IPR003657WRKY domain
SMARTSM007742.5E-3469127IPR003657WRKY domain
PfamPF031064.3E-2570126IPR003657WRKY domain
Gene3DG3DSA:2.20.25.804.5E-38229304IPR003657WRKY domain
SuperFamilySSF1182908.11E-30236304IPR003657WRKY domain
PROSITE profilePS5081138.825239304IPR003657WRKY domain
SMARTSM007743.1E-39244303IPR003657WRKY domain
PfamPF031061.4E-26245302IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
XPFASSPLAE SEPADPSNEL SLSSPVQKVS SVEVDLDEFN HRGNASTGLQ ASHVEVRGSG  60
APIAPEKASD DGYNWRKYGQ KLVKGSEFPR SYYKCTHPNC EVKKLFERSH DGQITEIIYK  120
GTHDHPKPQP SRRYSAGTGM SVQEERSDKA SLAGQDDRAS GMYGRGCHAA DPNSTPELSP  180
RATNDDSPEG AGFMSNRTND EVDDDDPFLK RRRMELGNAD ITPVVKPIRE PRVVVQTLSE  240
VDILDDGYRW RKYGQKVVRG NPNPRSYYKC TNAGCPVRKH VERASHDPKA VITTYEGKHN  300
HDVPAARSSS HDX
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A9e-3970305878Probable WRKY transcription factor 4
2lex_A9e-3970305878Probable WRKY transcription factor 4
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015973001.10.0PREDICTED: probable WRKY transcription factor 20 isoform X1
RefseqXP_015973002.10.0PREDICTED: probable WRKY transcription factor 20 isoform X2
SwissprotQ93WV01e-127WRK20_ARATH; Probable WRKY transcription factor 20
TrEMBLA0A0R0GHY70.0A0A0R0GHY7_SOYBN; Uncharacterized protein
STRINGGLYMA14G01980.10.0(Glycine max)